| Product Name | TARC Human |
|---|---|
| Product description | CCL17 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 8 kDa. |
| Source | Escherichia Coli. |
| Sequence Similarities | ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRD |
| SwissProt ID | Q92583 |
| Storage Instructions | Lyophilized TARC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TARC should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | The protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4. |
Data sheet for OM301813